Szerző: Marton Attila | 2013. október 22.

A viziló a disznóval vagy a bálnával közelebbi rokon?

Darwin legvadabb álmában sem merült fel, hogy egy nap majd az élőlények testének apró részecskéit összehasonlítva képesek leszünk megmondani, hogy három élőlény közül mely kettő áll közelebbi rokonsági fokban egymással (vagyis melyiknek volt később közös ősük). Élő és kihalt élőlények fehérjéit, DNS szekvenciáit összehasonlítva eddig soha nem ismert pontossággal rajzolhatunk fel törzsfákat, és néha olyan eredményekre is bukkanhatunk, melyek teljesen felborítják a morfológiai bélyegek alapján elkészített törzsfánkat. A következőkben a viziló (Hippopotamus amphibius), a házi sertés (Sus scrofa) és a csukablána (Balaena rostrata) alfa és béta hemoglobin alegységét fogom összehasonlítani:

Kép

Alfa alegységek összehasonlítása:

1. Viziló alfa hemoglobin alegység szekvenciája:

VLSANDKSNVKAAWGKVGNHAPEYGAEALERMFLSFPTTKTYFPHFDLSHGSSQVKAHGK
KVADALTKAVGHLDDLPGALSDLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPSDFTPA
AHASLDKFLANVSTVLTSKYR

2. Házi sertés alfa hemoglobin alegység szekvenciája:

VLSAADKANVKAAWGKVGGQAGAHGAEALERMFLGFPTTKTYFPHFNLSHGSDQVKAHGQ
KVADALTKAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPDDFNPS
VHASLDKFLANVSTVLTSKYR

3. Csukabálna alfa hemoglobin alegység szekvenciája:

MVLSPTDKSNVKATWAKIGNHGAEYGAEALERMFMNFPSTKTYFPHFDLGHDSAQVKGHG
KKVADALTKAVGHMDNLLDALSDLSDLHAHKLRVDPANFKLLSHCLLVTLALHLPAEFTP
SVHASLDKFLASVSTVLTSKYR

Az alfa alegységek összehasonlítása BLAST-ban:

a) Víziló és sertés hemoglobin alfa alegységének hasonlósága: 89%

Sequence ID: lcl|59083Length: 141Number of Matches: 1
Related Information
Alignment statistics for match #1
Score Expect Method Identities Positives Gaps
268 bits(883) 9e-97 Compositional matrix adjust. 125/141(89%) 131/141(92%) 0/141(0%)
Query  1    VLSANDKSNVKAAWGKVGNHAPEYGAEALERMFLSFPTTKTYFPHFDLSHGSSQVKAHGK  60
            VLSA DK+NVKAAWGKVG +A  +GAEALERMFL FPTTKTYFPHF+LSHGS QVKAHG+
Sbjct  1    VLSAADKANVKAAWGKVGGQAGAHGAEALERMFLGFPTTKTYFPHFNLSHGSDQVKAHGQ  60

Query  61   KVADALTKAVGHLDDLPGALSDLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPSDFTPA  120
            KVADALTKAVGHLDDLPGALS LSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHP DF P+
Sbjct  61   KVADALTKAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPDDFNPS  120

Query  121  AHASLDKFLANVSTVLTSKYR  141
             HASLDKFLANVSTVLTSKYR
Sbjct  121  VHASLDKFLANVSTVLTSKYR  141

b) Víziló és bálna hemoglobin alfa alegységének azonossága: 82%

Sequence ID: lcl|32833Length: 142Number of Matches: 1
Related Information
Alignment statistics for match #1
Score Expect Method Identities Positives Gaps
252 bits(830) 1e-90 Compositional matrix adjust. 115/141(82%) 126/141(89%) 0/141(0%)
Query  1    VLSANDKSNVKAAWGKVGNHAPEYGAEALERMFLSFPTTKTYFPHFDLSHGSSQVKAHGK  60
            VLS  DKSNVKA W K+GNH  EYGAEALERMF++FP+TKTYFPHFDL H S+QVK HGK
Sbjct  2    VLSPTDKSNVKATWAKIGNHGAEYGAEALERMFMNFPSTKTYFPHFDLGHDSAQVKGHGK  61

Query  61   KVADALTKAVGHLDDLPGALSDLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPSDFTPA  120
            KVADALTKAVGH+D+L  ALSDLSDLHAHKLRVDP NFKLLSHCLLVTLA H P++FTP+
Sbjct  62   KVADALTKAVGHMDNLLDALSDLSDLHAHKLRVDPANFKLLSHCLLVTLALHLPAEFTPS  121

Query  121  AHASLDKFLANVSTVLTSKYR  141
             HASLDKFLA+VSTVLTSKYR
Sbjct  122  VHASLDKFLASVSTVLTSKYR  142

c) sertés és bálna hemoglobin alfa alegységének azonossága: 77%

Sequence ID: lcl|21631Length: 142Number of Matches: 1
Related Information
Alignment statistics for match #1
Score Expect Method Identities Positives Gaps
233 bits(767) 2e-83 Compositional matrix adjust. 108/141(77%) 120/141(85%) 0/141(0%)
Query  1    VLSAADKANVKAAWGKVGGQAGAHGAEALERMFLGFPTTKTYFPHFNLSHGSDQVKAHGQ  60
            VLS  DK+NVKA W K+G +   +GAEALERMF+ FP+TKTYFPHF+L H S QVK HG+
Sbjct  2    VLSPTDKSNVKATWAKIGNHGAEYGAEALERMFMNFPSTKTYFPHFDLGHDSAQVKGHGK  61

Query  61   KVADALTKAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPDDFNPS  120
            KVADALTKAVGH+D+L  ALS LSDLHAHKLRVDP NFKLLSHCLLVTLA H P +F PS
Sbjct  62   KVADALTKAVGHMDNLLDALSDLSDLHAHKLRVDPANFKLLSHCLLVTLALHLPAEFTPS  121

Query  121  VHASLDKFLANVSTVLTSKYR  141
            VHASLDKFLA+VSTVLTSKYR
Sbjct  122  VHASLDKFLASVSTVLTSKYR  142

Ugyanezt megnézzük a béta alegység esetében is:

Béta alegységek összehasonlítása:

1. Víziló béta hemoglobin alegység szekvenciája:

VHLTAEEKDAVLGLWGKVNVQEVGGEALGRLLVVYPWTQRFFESFGDLSSADAVMNNPKV
KAHGKKVLDSFADGLKHLDNLKGTFAALSELHCDQLHVDPENFRLLGNELVVVLARTFGK
EFTPELQAAYQKVVAGVANALAHRYH

2. Házi sertés béta hemoglobin alegységének szekvenciája:

MVHLSAEEKEAVLGLWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSNADAVMGNPK
VKAHGKKVLQSFSDGLKHLDNLKGTFAKLSELHCDQLHVDPENFRLLGNVIVVVLARRLG
HDFNPNVQAAFQKVVAGVANALAHKYH

3. Csukabálna béta hemoglobin alegységének szekvenciája:

VHLTAEEKSAVTALWAKVNVEEVGGEALGRLLVVYPWTQRFFEAFGDLSTADAVMKNPKV
KAHGKKVLASFSDGLKHLDDLKGTFATLSELHCDKLHVDPENFRLLGNVLVIVLARHFGK
EFTPELQAAYQKVVAGVANALAHKYH

A béta alegységek összehasonlítása BLAST-ban:

a) Víziló és sertés hemoglobin béta alegységének hasonlósága: 87%

Sequence ID: lcl|2911Length: 147Number of Matches: 1
Related Information
Alignment statistics for match #1
Score Expect Method Identities Positives Gaps
281 bits(927) 8e-102 Compositional matrix adjust. 127/146(87%) 137/146(93%) 0/146(0%)
Query  1    VHLTAEEKDAVLGLWGKVNVQEVGGEALGRLLVVYPWTQRFFESFGDLSSADAVMNNPKV  60
            VHL+AEEK+AVLGLWGKVNV EVGGEALGRLLVVYPWTQRFFESFGDLS+ADAVM NPKV
Sbjct  2    VHLSAEEKEAVLGLWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSNADAVMGNPKV  61

Query  61   KAHGKKVLDSFADGLKHLDNLKGTFAALSELHCDQLHVDPENFRLLGNELVVVLARTFGK  120
            KAHGKKVL SF+DGLKHLDNLKGTFA LSELHCDQLHVDPENFRLLGN +VVVLAR +G 
Sbjct  62   KAHGKKVLQSFSDGLKHLDNLKGTFAKLSELHCDQLHVDPENFRLLGNVIVVVLARRLGH  121

Query  121  EFTPELQAAYQKVVAGVANALAHRYH  146
            +F P +QAA+QKVVAGVANALAH+YH
Sbjct  122  DFNPNVQAAFQKVVAGVANALAHKYH  147

b) Víziló és bálna hemoglobin béta alegységének azonossága: 88%

Sequence ID: lcl|5095Length: 146Number of Matches: 1
Related Information
Alignment statistics for match #1
Score Expect Method Identities Positives Gaps
286 bits(946) 6e-104 Compositional matrix adjust. 129/146(88%) 137/146(93%) 0/146(0%)
Query  1    VHLTAEEKDAVLGLWGKVNVQEVGGEALGRLLVVYPWTQRFFESFGDLSSADAVMNNPKV  60
            VHLTAEEK AV  LW KVNV+EVGGEALGRLLVVYPWTQRFFE+FGDLS+ADAVM NPKV
Sbjct  1    VHLTAEEKSAVTALWAKVNVEEVGGEALGRLLVVYPWTQRFFEAFGDLSTADAVMKNPKV  60

Query  61   KAHGKKVLDSFADGLKHLDNLKGTFAALSELHCDQLHVDPENFRLLGNELVVVLARTFGK  120
            KAHGKKVL SF+DGLKHLD+LKGTFA LSELHCD+LHVDPENFRLLGN LV+VLAR FGK
Sbjct  61   KAHGKKVLASFSDGLKHLDDLKGTFATLSELHCDKLHVDPENFRLLGNVLVIVLARHFGK  120

Query  121  EFTPELQAAYQKVVAGVANALAHRYH  146
            EFTPELQAAYQKVVAGVANALAH+YH
Sbjct  121  EFTPELQAAYQKVVAGVANALAHKYH  146

c) sertés és bálna hemoglobin béta alegységének azonossága: 84%

Sequence ID: lcl|43911Length: 146Number of Matches: 1
Related Information
Alignment statistics for match #1
Score Expect Method Identities Positives Gaps
275 bits(908) 2e-99 Compositional matrix adjust. 123/146(84%) 134/146(91%) 0/146(0%)
Query  2    VHLSAEEKEAVLGLWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSNADAVMGNPKV  61
            VHL+AEEK AV  LW KVNV+EVGGEALGRLLVVYPWTQRFFE+FGDLS ADAVM NPKV
Sbjct  1    VHLTAEEKSAVTALWAKVNVEEVGGEALGRLLVVYPWTQRFFEAFGDLSTADAVMKNPKV  60

Query  62   KAHGKKVLQSFSDGLKHLDNLKGTFAKLSELHCDQLHVDPENFRLLGNVIVVVLARRLGH  121
            KAHGKKVL SFSDGLKHLD+LKGTFA LSELHCD+LHVDPENFRLLGNV+V+VLAR +G 
Sbjct  61   KAHGKKVLASFSDGLKHLDDLKGTFATLSELHCDKLHVDPENFRLLGNVLVIVLARHFGK  120

Query  122  DFNPNVQAAFQKVVAGVANALAHKYH  147
            +F P +QAA+QKVVAGVANALAHKYH
Sbjct  121  EFTPELQAAYQKVVAGVANALAHKYH  146

A kapott eredmények alapján elmondhatjuk, hogy a víziló és a sertés közelebbi rokonságban állnak egymással, mint a bálnával. Felrajzolható törzsfa:

                              I————————- Hippopotamus amphibius
             I————-I
I———-I                 I————————– Sus scrofa

I

            I ———————————————————– Balaena rostrata

Reklámok

Vélemény, hozzászólás?

Adatok megadása vagy bejelentkezés valamelyik ikonnal:

WordPress.com Logo

Hozzászólhat a WordPress.com felhasználói fiók használatával. Kilépés / Módosítás )

Twitter kép

Hozzászólhat a Twitter felhasználói fiók használatával. Kilépés / Módosítás )

Facebook kép

Hozzászólhat a Facebook felhasználói fiók használatával. Kilépés / Módosítás )

Google+ kép

Hozzászólhat a Google+ felhasználói fiók használatával. Kilépés / Módosítás )

Kapcsolódás: %s

Kategóriák

%d blogger ezt kedveli: